%0 Journal Article %1 profdravichandranashwindhivakarmr2015hybrid %A Prof D. Ravichandran, Ashwin Dhivakar M R, Dr. Vijay Dakha %D 2015 %E Paul, Antony %J International Journal of Advanced Engineering, Management and Science %K %N 3 %P 20-24 %T Hybrid Algorithmic Approach for Medical Image Compression Based on Discrete Wavelet Transform (DWT) and Huffman Techniques for Cloud Computing %U http://ijaems.com/issue-june-2015.php %V 1 %X As medical imaging facilities move towards complete filmless imaging and also generate a large volume of image data through various advance medical modalities, the ability to store, share and transfer images on a cloud-based system is essential for maximizing efficiencies. The major issue that arises in teleradiology is the difficulty of transmitting large volume of medical data with relatively low bandwidth. Image compression techniques have increased the viability by reducing the bandwidth requirement and cost-effective delivery of medical images for primary diagnosis.Wavelet transformation is widely used in the fields of image compression because they allow analysis of images at various levels of resolution and good characteristics. The algorithm what is discussed in this paper employs wavelet toolbox of MATLAB. Multilevel decomposition of the original image is performed by using Haar wavelet transform and then image is quantified and coded based on Huffman technique. The wavelet packet has been applied for reconstruction of the compressed image. The simulation results show that the algorithm has excellent effects in the image reconstruction and better compression ratio and also study shows that valuable in medical image compression on cloud platform.

@article{profdravichandranashwindhivakarmr2015hybrid, abstract = {As medical imaging facilities move towards complete filmless imaging and also generate a large volume of image data through various advance medical modalities, the ability to store, share and transfer images on a cloud-based system is essential for maximizing efficiencies. The major issue that arises in teleradiology is the difficulty of transmitting large volume of medical data with relatively low bandwidth. Image compression techniques have increased the viability by reducing the bandwidth requirement and cost-effective delivery of medical images for primary diagnosis.Wavelet transformation is widely used in the fields of image compression because they allow analysis of images at various levels of resolution and good characteristics. The algorithm what is discussed in this paper employs wavelet toolbox of MATLAB. Multilevel decomposition of the original image is performed by using Haar wavelet transform and then image is quantified and coded based on Huffman technique. The wavelet packet has been applied for reconstruction of the compressed image. The simulation results show that the algorithm has excellent effects in the image reconstruction and better compression ratio and also study shows that valuable in medical image compression on cloud platform.}, added-at = {2015-10-22T22:29:14.000+0200}, author = {{Prof D. Ravichandran, Ashwin Dhivakar M R}, Dr. Vijay Dakha}, biburl = {https://www.bibsonomy.org/bibtex/2c2c2d4cf9a76f60dd134cb0ae72b0294/drcplus2002}, description = {The above mentioned article is very good. The author demonstrated how to implement image ecompression techniques using wavelet using Matlab. But they did not justify why 'Haar' wavelet was chosen for his implementation...}, editor = {Paul, Antony}, interhash = {ba9e84ffd49391bbfbadc003e5baab0e}, intrahash = {c2c2d4cf9a76f60dd134cb0ae72b0294}, journal = {International Journal of Advanced Engineering, Management and Science}, keywords = {}, month = {June}, note = {I am doing phd in the same domain.}, number = 3, pages = {20-24}, timestamp = {2015-10-22T22:29:14.000+0200}, title = {Hybrid Algorithmic Approach for Medical Image Compression Based on Discrete Wavelet Transform (DWT) and Huffman Techniques for Cloud Computing }, url = {http://ijaems.com/issue-june-2015.php}, volume = 1, year = 2015 }